EVA results for 1kqi:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,...
seq	KCLAEAADCSPWSGDSCCKPYLCSCIFFYPCSCRPKGW
dssp	--E---EE--------E----EEE-------EEE----
apssp	-E------------------------E-----------	-5.8	-39.1	-0.30
jpred	--------------------------------------	-0.7	-53.3	-0.34
phd	--HHH----------------EEEEEEEEE--------	-9.0	-25.3	-0.24
phdpsi	---------------------EEEE-------------	+4.3	-27.9	-0.17
prof_king	--------------------------------------	-1.5	-54.4	-0.35
profsec	---------------------EEE--------------	+4.6	-29.9	-0.06
psipred	-----------------HHHHHHHHEEEE---------	-26.7	-42.7	-0.33
samt99_sec	--HHHH--------------EEEEEEEEE---------	-18.1	-28.5	-0.35
sspro2	--HHHH---------------EEEEEEE----------	-14.5	-28.2	-0.37

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)