Home - sec cm con - Bottom

EVA results for 1g2c:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4
seq	PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAG
dssp	-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------
jpred	---------HHHHHHHHHHHHHHHHHHHHHHHHHHH----	+10.4	+28.2	+0.01
phd	------HHHHHHHHHHHHHHHHHHHHHH-HHHHHHH----	+18.1	+0.8	+0.20
phdpsi	------HHHHHHHHHHHHHHHHHHHHHH-HHHHHHH----	+15.4	-1.0	+0.17
prof1	------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---	+13.0	+21.8	+0.1
prof_king	--------HHHHHHHHHHHHHHHHHHHH--HHHHHH----	+8.1	-1.7	-0.03
psipred	-------HH-HHHHHHHHHHHHHHHHHHHHHHHH------	+15.8	-9.7	+0.28
pssp	--EE-----HHHHHHHHHHHHHHHHHHHHHHHHH------	+21.3	+28.8	+0.39
sspro	------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----	+18.8	+29	+0.32

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec cm con - Top