EVA results for 1r4g:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5...
seq	KPTMHSLRLVIESSPLSRAEKAAYVKSLSKCKTDQEVKAVMELVEEDIESLTN
dssp	---HHHHHHHH-------HHHHHHHHHHH-----HHHHHHHHHHHHHHHHH--
apssp2	----EEEEEEEE-----HHHHHHHHHHHH----HHHHHHHHHHHHHHHHHH--	+4.3	+13.3	+0.11
jufo	-----EEEEEEE-----HHHHHHHHHHHH-----HHHHHHHHHHHHHHH----	+8.5	+17.0	+0.09
phd	----HHHHHH-------HHHHHHHHHHHHH----HHHHHHHHHHHHHHHH---	+19.1	+32.4	+0.22
phdpsi	----HHHHHH-------HHHHHHHHHHHHH----HHHHHHHHHHHHHHHH---	+17.8	+31.3	+0.2
prof_king	---HEEEHHHE------HHHHHHHHHHHH----HHHHHHHHHHHHHHHHH---	+14.3	+13.5	+0.26
profsec	---HHHHHHHH------HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH---	+17.5	+26.0	+0.23
prospect	-----EEEEEEE-----HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH---	+4.0	+13.9	+0.01
psipred	---HHHHHHHH------HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHH--	+18.4	+25.1	+0.34
sable	--HHHHHHHHE------HHHHHHHHHHHHH----HHHHHHHHHHHHHHHH---	+15.0	+24.7	+0.20
sable2	--HHHHHHHHH-----HHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH---	+12.0	+24.6	+0.05
samt99_sec	---HHHEEEEE------HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH---	+7.6	+19.4	+0.15
scratch	-----EEEEEE------HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH---	+2.0	+10.2	+0.04
sspro4	-----EEEEEE------HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH---	+1.8	+15.4	+0.01
yaspin	-----EEEEEE------HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH--	+5.4	+9.9	0.00

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)