EVA results for 1q3j:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK
dssp	------EEE------------EE-------EEE---
apssp2	--------------------EEE-----E----E--	0.0	-11.2	-0.32
jufo	--------------------HHEE------------	+5.3	-11.8	-0.27
phd	---------------EEE----------EEEEEE--	-1.8	-17.5	-0.27
phdpsi	---------------EEE----------EEEEEE--	-3.3	-18.8	-0.29
prof_king	------------------------------------	+4.9	-41.4	-0.32
profsec	------E-------------EEEE---EEEEEEE--	+2.9	+9.5	-0.16
prospect	------------------------------------	+6.0	-40.8	-0.3
psipred	-------------------------------EEE--	+4.9	-27.4	-0.25
sable	---------------------EE-----EEEEEE--	+5.6	-1.8	-0.13
samt99_sec	---------------------EE--------E----	+10.8	+0.8	+0.02
scratch	---------------------------EEEEEE---	+2.1	-25.5	-0.27

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)