EVA results for 1pb5:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,
seq	EEACELPECQEDAGNKVCSLQCNNHACGWDGGDCS
dssp	--------HHHH----------------HHHH---
phd	-----------------------------------	+6.1	-26.6	-0.29
phdpsi	-----------------------------------	+4.3	-28.3	-0.32
prof_king	---------HHH-----------------------	+12.6	+12.5	+0.05
profsec	-----------------------------------	+2.0	-31.6	-0.35
prospect	--------HHHHH----------------------	+13.7	+13.2	-0.03
psipred	-----HHHHHHH-----------------------	+4.5	+4.6	-0.23
samt99_sec	----HHHHHHHH-----------------------	+2.2	+2.8	-0.23
scratch	------HHHHH-----EE-----------------	-0.7	-11.9	-0.23

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)