EVA results for 1p4q:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5..
seq	GSGSGSGSNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDF
dssp	-------------------HHHHHHHHH------------------HHH---
jufo	-----------------HHHHHHHHHHHH--HHHH--HHHH-----------	+3.3	-17.9	-0.11
phd	-------------HHHHHHHHHHHHHH----HHHH-HHHH--------EE--	-7.5	-16.9	-0.20
phdpsi	-------------HHHHHHHHHHHHHH----HHHH-HHHH--------EE--	-9.1	-18.4	-0.22
prof_king	-----------------HHHHHHHHHHH--HHHHH-HHHH------------	0.0	-21.1	-0.16
profsec	-----------------HHHHHHHHHH----HHHH-HHHH------------	-1.8	-21.9	-0.23
prospect	-----------------HHHHHHHHHHH--------HHHH------------	+10.9	+3.3	-0.05
psipred	-----------------HHHHHHHHHHHHHHHHHHHHHHH------------	-8.1	-6.6	-0.27
samt99_sec	-----------------HHHHHHHHHHH--HHHHHHHHHHH---HHHHH---	-3.4	-12.1	-0.03
scratch	-----------------HHHHHHHHHHH-HHHHHH--HHH------------	-1.7	-22.4	-0.19

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)