EVA results for 1owt:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,.
seq	SDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
dssp	----------EEEEEE-----EEHHHHHHHHHHHHH---EEEEE----------EE-EEEEEEEE-
jufo	---------------HHHH--------HHHHHHHH-----------------------EEEE----	-11.1	-10.8	-0.05
phd	---EE------------HHHH-----HHHHHHHHH----EEEE---EE-------EE-EEEEEE--	-8.7	-6.0	-0.05
phdpsi	---EE------------HHHH-----HHHHHHHHH----EEEE---EE-------EE-EEEEEE--	-10.7	-7.8	-0.07
prof_king	--EEE--------EE----H------HHHHHHHHHHH---EEEEEEEE----------EEEEE---	-9.5	-4.6	-0.02
profsec	-------------HHHHHHHHH----HHHHHHHHH-----EEEE--EEE---------EEEEE---	-14.3	-9.6	-0.18
prospect	----------EE---HHHHHHHHH-HHHHHHHHHHH----EE----EEE----------EEEEE--	-6.4	-10.7	-0.04
psipred	-----------HHHHHHHHH---HHHHHHHHHHHHHH---EEEEEEEE----------EEEEE---	-10.3	-3.6	-0.08
samt99_sec	--EEE------E-----HHH---HHHHHHHHHHHHHH---EEE-EEEE----------EEEEE---	-12.5	-9.8	+0.03
scratch	--EEE------E--HHHHHH---HH-HHHHHHHHHHH----E-----E-------E-EEEEEE---	-11.7	-16.3	-0.09

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)