EVA results for 1oqd:K

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....
seq	CSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVT
dssp	----EEEE----EEEEHHHHH------HHHH-HHHH---
jufo	-----HHHHHHHH-----EE-------------------	-34.3	-47.8	-0.08
phd	----E----------------------------------	-22.1	-47.1	-0.10
phdpsi	----E----------------------------------	-24.1	-48.9	-0.12
prof_king	------HHHHHHH--------------------------	-37.2	-51.9	-0.18
profsec	----HHH--HHH---------------------------	-36.4	-51.1	-0.21
prospect	-----HHHHHHHH-----EE-------------------	-35.7	-48.5	-0.11
psipred	---HHHHHHHHHH----EEEE------------------	-42.2	-52.4	-0.10
samt99_sec	----HHHHHHHHH-----EE------------E------	-38.7	-42.4	-0.09
scratch	--HHHHHHHHHHH------E-------------------	-44.5	-54.3	-0.14

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)