EVA results for 1nsl:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4
seq	GXFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLF
dssp	---EEE----EEEEE--HHHHHHHHHHHH-----------
phd	--EEEEEEEEEEEE--HHHHHHHHHHHHH---HHHHHH--	-3.6	-14.7	+0.12
phdpsi	--EEEE---EEEE----HHHHHHHHHHHHHH-HHHHHHH-	-5.2	-10.2	+0.10
prof_king	---EEE---EEEEE----HHHHHHHHHHHH----EEEEE-	+4.5	+0.8	+0.19
profsec	--EEEEE--EEEEEE--HHHHHHHHHHHH----HHHH---	+7.4	+1.5	+0.25
psipred	-EEEEE---EEEEE---HHHHHHHHHHHH---HHHHHH--	-0.6	-6.8	+0.11
sable	--EEEE---EEEEE---HHHHHHHHHHHH---HHHHH---	-2.5	-1.8	+0.12
samt99_sec	----EE---EEEEE---HHHHHHHHHHHH--HHHHH----	+5.1	+4.4	+0.19
scratch	---------EEEEE---HHHHHHHHHHHH----HEE----	+4.7	-3.2	+0.20

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)