EVA results for 1nj7:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,...
seq	DQNCDIGNITSQCQMQHKNCEDANGCDTIIEECKTSMVERCQNQEFESAAGSTTLGPQ
dssp	---------HHHHHHH-------------HHHHHHHHH---HHHH-------------
jufo	---------HHHHHHHHH----------HHHHHHHHHHHHH-----------------	+12.6	+20.7	+0.03
phd	----------HHH---------------EEEHHHHHHHHHH--HHHH-----------	+5.0	+19.2	-0.09
phdpsi	----------HHH---------------EEEHHHHHHHHHH--HHHH-----------	+3.0	+17.5	-0.11
prof_king	----------HHH-------------HHHHHH---HHHH-------------------	+0.9	+3.4	-0.19
profsec	----------HHH---------------HHHHHH---EEEEE-EEEEE----------	-7.7	+7.8	-0.17
prospect	---------HHHH---------------HHHHHH--HHHHH--HHHHHHH--------	+0.7	+9.7	-0.18
psipred	---------HHHHHHH---------HHHHHHHHHHHHHHHHH----------------	+7.2	+12.7	-0.03
samt99_sec	-----------HHHHHH-----------HHHHHHHHHHHH-----HHH----------	+2.9	+19.8	-0.14
scratch	----------HHHHHH------------HHHH----HHHH-----EE-----------	+0.5	+4.5	-0.14

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)