EVA results for 1nix:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3...
seq	ECKGFGKSCVPGKNECCSGYACNSRDKWCKVLL
dssp	--E----E-------E---EEE-----EEEE--
apssp2	--------------HH---------HHHHHH--	-14.3	-34.3	-0.23
phd	---------------E----EE------EEEEE	+10.9	-0.0	-0.05
phdpsi	---------------E----EE------EEEEE	+8.8	-1.9	-0.07
prof_king	---------------------------EEEEE-	+5.7	-37.0	-0.12
profsec	--------------------EEE---EEEEEEE	+0.6	-25.7	-0.21
psipred	------------------------HHHHHHH--	-15	-50	-0.29
sspro2	------------------------H-HHHHHH-	-13.7	-49.5	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)