EVA results for 1ngm:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7..
seq	GSYCPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQE
dssp	-------HHH---HHHHH-----------------HHH----HHHHHHHHHHHHHH---HHHHHHH------
apssp2	-------EEE----HHHHHHH-----------HHHHHHHHH-HHHHHHHHHEEE---HHHHHHHHHHHHH--	-8.2	+5.3	-0.10
phd	-------------HHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHH---	+4.1	+5.1	-0.07
phdpsi	-------------HHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHH---	+2.0	+3.2	-0.09
profsec	--------------HHHHHH------------HHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHH---	-2.9	-2.8	-0.19
prospect	-------------HHHHHH-------------HHHH------HHHHHHHHHHHHH--HHHHHHHHHHHH---	+7.0	+12.7	-0.04
psipred	-------EEE---HHHHHHH------------HHHHHHH---HHHHHHHHHHHHH--HHHHHHHHHHHH---	+3.6	+15.2	+0.03
scratch	---------------HHHH-------------HHHHHHH---HHHHHHHHHHEH---HHHHHHHHHHHH---	-1.3	-3.7	-0.14

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)