EVA results for 1ng7:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6
seq	MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA
dssp	----------------------HHHHHHH--HHHHHHHHHH-------------------
jufo	--------EEEE--------HHHHHHH----HHHHHHH----EEEE-------HHH----	-0.0	-16.8	-0.01
phd	-------EEEEE-------HHHHHHHHH---HHHHHHHHH---EEE----HHHHHHH---	-4.3	-24.2	-0.02
phdpsi	-------EEEEE-------HHHHHHHHH---HHHHHHHHH---EEE----HHHHHHH---	-5.9	-25.7	-0.04
prof_king	-------EEEEEE------HHHHHHHHH---HHHHHHHHH---EEEE---EEEEE-----	-6.2	-26.1	+0.13
profsec	-------EEEEE------HHHHHHHHH----HHHHHHHHH---EEEE----EEEEE----	-9.9	-29.6	+0.01
prospect	--------EEE---------HHHHHHH---HHHHHHHHH---EEEE----EEEEEE----	-5.1	-21.5	+0.04
psipred	-----EEEEEEE-------HHHHHHHHH---HHHHHHHHH---EE------EEE------	-3.8	-25.4	+0.07
samt99_sec	-----EEEEEEE-------HHHHHHHHHH-HHHHHHHHHH--EEE-----HHHHHHHHH-	-14.7	-32.4	-0.07
scratch	-----EEEEEEE-------HHHHHHHHH---HHHHHHHHH---EEEE--EEEEEEE----	-13.1	-30.9	+0.10

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)