EVA results for 1ne5:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
dssp	----HHH------EE--HHHHHHHHHH----EEEE---EEE-
apssp2	-------HHHHHH---HHHHHHHHH-------EEEEEEEE--	-20.1	-19.1	-0.15
phd	-----------E--------HHHH---------EE-------	-11.3	-23.8	-0.07
phdpsi	-----------E--------HHHH---------EE-------	-13.4	-25.7	-0.09
prof_king	--------------------------------EEEEEEEE--	-20.6	-51.7	-0.11
profsec	----------HHH--------HHH---------EEEEEE---	-27.5	-34.7	-0.24
prospect	------------EEEEE-----HHHHHHHHH-----------	-24.5	-34.1	-0.19
psipred	-------HHHHH-----HHHHHHHHH-------EEEEEEE--	-16.1	-18.4	-0.15
scratch	--------HHHHH---HHH-HHHHH-------EEEEEEEE--	-21.5	-29.7	-0.15
jufo	----------------HHHHHHHH----------EEEEE---	-14.3	-25.1	-0.07

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)