EVA results for 1n0w:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3...
seq	PTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ
dssp	-HHH--EE----E----HHHHHH----------
apssp	---EE-E-----EEEEHHHHHHHHHH-------	-36.6	-35.1	-0.31
apssp2	--EEEEE-----EEEHHHHHHHHHHHHH-----	-20	-19.6	-0.21
phd	-------------EEEHHHHHHHHHHHH-----	-15.1	-23.7	-0.12
phdpsi	-------------EEEHHHHHHHHHHHH-----	-17.8	-26.0	-0.16
prof_king	-EEEEEEE----EEEEEHHHHHHHHHH-HH---	-18.5	-30.9	-0.08
profsec	-----EE----EEEEE-HHHHHHHHHHHHHHH-	-29.4	-35.3	-0.21
prospect	--EEEEE-----EEEE-HHHHHHHHHH------	-11.0	-4.8	-0.13
psipred	--EEEEE-----EEEHHHHHHHHHHHHHHH---	-27.0	-32.8	-0.25
sspro2	-EEE--------EEEEEHHHHHHHHHH------	-13.5	-10.6	-0.09

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)