EVA results for 1mt1:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,.
seq	PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
dssp	----------EEEEEEEEEE---HHHHHHHHHHHH-----EEEE--
apssp2	HHHHHH----EEEEEE---------HHHHHHHHH-----EEEEEE-	-7.5	+12.7	-0.02
phd	--EEE-E---EEEEEE--------HHHHHHHHHHH-----EEEEE-	+7.4	-5.3	+0.23
phdpsi	--EEE-E---EEEEEE--------HHHHHHHHHHH-----EEEEE-	+5.3	-7.2	+0.21
prof_king	-EEEEEE---EEEEEE-------------HHHHH-----EEEEEE-	-14.3	-11.6	-0.02
profsec	--EEEE----EEEEEE-------HHHHHHHHHHHH------EEE--	+5.2	+4.2	+0.24
psipred	HHHHHH----EEEEEEE-------HHHHHHHHHH-----EEEEEE-	-3.8	+13.9	+0.02
samt99_sec	----------EEEEE-------HHHHHHHHHHHHH----EEEEEE-	+7.7	+17.4	+0.24
scratch	---EEEE---EEEEEE-------------HHHHH-----EEEEEE-	-13.3	-9.2	-0.03

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)