EVA results for 1mm0:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG
dssp	---HHHHHHHHHHH----EEEEEEE--EEEEEE---
jufo	-------HHHHH---HHHHHHHH-----EEEEEEE-	-23	-16.4	-0.16
phd	-------HHHHHHHHHHHHHHHH-------EEEEE-	-26.4	-28.1	-0.22
phdpsi	-------HHHHHHHHHHHHHHHH-------EEEEE-	-28.4	-29.9	-0.24
profsec	----HHHHHHHHHHH-HHHHHHH------EEEEEE-	-16.6	-10.0	-0.15
prospect	HHHHHHHHH-HHHHH---------------------	-21.6	-35.6	+0.12
psipred	---HHHHHHHHHHHHHHHHHHHH------EEEEE--	-14.4	-14.0	-0.10
samt99_sec	----HHHHHHHHHHHHHHEHHHH------EEEEE--	-13.5	-2.4	-0.13
scratch	------HHHHHHHHHHEHHEHHH------EEEEEE-	-22.5	-12.0	-0.22

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)