EVA results for 1mb6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,
seq	ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI
dssp	--E----E-------E-----EEEE----EEEE--
apssp2	-HHHHHH-------HHHE----EEE----E-----	-26.1	-15.1	-0.41
prof_king	--EEEEE-------------EEEEE----EEEE--	+5.4	-2.7	-0.07
prospect_secstruc	-----HHHHH--------------------EE---	-8.7	-28.2	-0.21
psipred	-HHHHHH------HHHH-----EE-----EEE---	-17.9	-0.2	-0.15
samt99_sec	---HHHH--------------EE------E-----	-9.8	-17.4	-0.13
sspro2	-HHHHHH-------------EEEE----EEEEE--	-8.2	-7.6	-0.15
prospect	-----HHHHH--------------------EE---	-8.8	-27.7	-0.20

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)