EVA results for 1m4u:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....
seq	MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGG
dssp	----EE-------------------------HHH--HHHHHHHHHHH-----EE----------
apssp2	---EEEE------------HH---------------HHHHHHHH--------E-----------	+8.0	+2.2	0.00
phd	---EEE------------------------------HHHHHHHHH-------------------	+17.2	+14.8	+0.20
phdpsi	---EEE------------------------------HHHHHHHHH-------------------	+14.6	+12.6	+0.17
prof_king	---EE-----------EEEEE---------------HHHHHHHH--------------------	+3.2	-8.0	+0.01
profsec	--EEEEE----------HHHH---------------HHHHHHHH--------------------	+1.3	-11.2	-0.13
prospect	------------------------------HHHH--HHHHHHHH--------------------	+15.5	+11.8	+0.19
psipred	----EEEEE---------------------------HHHHHHHHH------EEEE---------	+8.7	+16.8	+0.15
samt99_sec	---EEEE---------EE-------------HHHHHHHHHHHHH-------HE-----------	+7.9	+0.5	+0.05
sspro2	---EEEE----------H------------------HHHHHHHH--------------------	+8.3	-2.6	-0.00

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)