EVA results for 1m2v:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7...
seq	FLTPAQEQLHQQIRPMNQLYPIDLLTELPPPITDLTLPPPPLVIPPERMLVPSELSNASPDYIRSTLNAVPKN
dssp	---HHHHHHHHH--------EEE----------HHH---------HHH--------------EEE-E--EE-E
apssp	-----HHHHH--------------------------------E-----EE-EEEE------E-EE-E------	-10.6	-31.3	-0.19
apssp2	--------------------------------------------------------------EEEEE------	-13.0	-58.8	-0.29
jpred	--------------------------------------------------------------EEE--------	-3.9	-48.9	-0.03
prof_king	------HH-------------------------------------EEEEEEE----------EEEEEE-----	-8.7	-26.9	-0.23
prospect	-------------------------------------------------------------EEEEEEEE----	-5.9	-50.4	-0.18
sspro2	-------------------------------------------------EEE---------EEEEEE------	-12.4	-43.8	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)