EVA results for 1lx8:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDLNRP
dssp	----HHHHHH-------HHHHHHHHH---EE---EEE--EEE-----EE------
apssp2	-EEEEHHH-HH------HHHHHHHHHH-----------HHHHHH--EEEEE----	-13.1	-13.3	-0.15
jufo	-EEE-HHH---------HHHHHHHHHHH----------HH--HHH----------	-9.6	-12.4	-0.05
phd	-E-EE---HHH--------HHHHHHHH-------------EEE----EE------	-1.7	-2.7	-0.05
phdpsi	-E-EE---HHH--------HHHHHHHH-------------EEE----EE------	-3.5	-4.3	-0.08
prof_king	--EE------------HHHHHHHHHHH-------------EEEE--EEEEE----	-11.1	-12.7	-0.09
profsec	-EEEEHHHHHH------HHHHHHHHHH------------EEEEE--EEEEE----	-4.0	-3.2	+0.07
prospect	----HHHHHHH------HHHHHHHHH-------------EEEEE---EEEE----	+10.0	+8.5	+0.26
psipred	-EEEEHH----------HHHHHHHHHH----------HHHHHH---EEEEE----	-15.4	-11.9	-0.22
samt99_sec	-EEEHHHHHHH------HHHHHHHHHHH------------EEE----EEE-----	-0.2	+3.0	+0.12
scratch	---EHHHHHHHH-----HHHHHHHHHH------------EEEEE--EEEEE----	-0.2	+2.9	+0.12

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)