EVA results for 1lv9:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....
seq	VRCTCISISNQPVNPRSLEKXEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK
dssp	-------------------EEEEEE-------EEEEEEE----EEEEE------HHHHHHHHH-
apssp	---EEEE---------------E---------EEEEEEE-----EEE----HHHHHHHHHHH--	+0.1	-2.8	-0.02
apssp2	---EEEEE--------------EE---------EEEEEE-----EEEE----HHHHHHHHHHH-	-3.2	-4.7	-0.06
jpred	----EEE--------------EE---------EEEEEEE-----EEE-----HHHHHHHHHH--	+7.3	+6.4	+0.10
prof_king	-EEEEEE-----------EEEEE----------EEEEEEE----EEEE----HHHHHHHHHH--	+2.0	+2.5	+0.05
psipred	---EEE---------------EEE---------EEEEEE----EEEEE---HHHHHHHHHHHH-	+6.5	+1.3	+0.13
sspro2	--EEEE--------HHHHHH--E---------EEEEEEE-----EEE----HHHHHHHHHHH--	-8.0	-9.6	-0.10

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)