EVA results for 1lv3:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,
seq	MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDDWSEEPKQ
dssp	-----EEE------EEE------------HHHHHHHH----------------------------
apssp	----EEE-------EEEE-E---HHHHHH-----------HH-----------------------	-7.3	-20.5	-0.14
apssp2	----EEE--------E-----------HHHHHHHHHHHHHHH-----------------------	0	+14.2	-0.10
prof_king	---EEEE-------EEEEE-------------EEEE-----H-----------------------	+3.9	-6.0	-0.08
psipred	----EEE--------------------HHHHH----HHHH-------------------------	+0.5	-3.2	-0.23
samt99_sec	----------------E-----------HHHHHHH-HHHHH----E-------------------	+5.8	-9.6	-0.05
sspro2	---EEEEE------EEEE-----------H--EEE-HHHHHHHH---------------------	-1.5	+6.6	-0.06

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)