EVA results for 1lub:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5
seq	MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKV
dssp	----EEE--EEE---HHH----------------HHHHHHHHHHHHHHH-
apssp	-------------------EEEEEEEEEE---EEEEEEE--EEEEEEEE-	+6.5	+19.8	+0.20
apssp2	----------EEEE-----EEEEEEEEEE----HHHEHHHHHEEEEEEE-	-30.6	-40.5	-0.20
jpred	-----------EEEE-----EEEEEEEEE---EEEEEEE--EEEEEE---	-46.8	-51.2	-0.28
phd	-----------------EEEEEEEEEEEEEEEEEEEEEE---EEEEEEE-	-49.8	-59.1	-0.12
phdpsi	-----------------EEEEEEEEEEEEEEEEEEEEEE---EEEEEEE-	-52.5	-61.4	-0.16
prof_king	------------------EEEEEEEEEEE---EEEEEEE--EEEEEEEE-	-47.2	-54.8	-0.17
profsec	-------------------EEEEEEEEEE---EE-EEEE--EEEEEEEE-	-47.2	-59.6	-0.23
prospect	-------------------EEEEEEEEEE---EEEEEE---EEEEEEEE-	-43.8	-55.5	-0.18
psipred	----------EEEE-----EEEEEEEEHHHHHHHHHHHHHHHEEEEEEE-	-37.7	-35.7	-0.29
sspro2	----------EEEE-----EEEEEEEEEEE---EEEEEE--EEEEEEE--	-46.3	-51.5	-0.32

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)