EVA results for 1lo6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	LVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWV
dssp	-E--EE--------EEEEEE--EEEEEEEEEE--EE
apssp	-E--EE--------EEEEEE--EEEEEEEEEE--EE	+23.3	+28.0	+0.6
apssp2	-E--EE--------EEEEEE--EEEEEEEEEE--EE	+16.4	+20.6	+0.46
phd	-------------EEEEEE-----E----EEEE-EE	-3.9	-17.5	-0.14
phdpsi	--------------EEEEEE---------EEEE-EE	-4.8	-10.0	-0.13
profsec	----EE-------EEEEEEE---EEEEEEEE---EE	+12.3	+20.8	+0.14
psipred	----EE--------EEEEEE---EEEEEEE----EE	+10.9	+17.7	+0.18
sspro2	----E--------EEEEEEE---EEE-EEEE---EE	+6.3	-0.9	+0.01

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)