EVA results for 1lmm:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4
seq	EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
dssp	--------E------------EEEE-----EEEE------
apssp2	------HHHHH-----HH-HHHHHHH----EEE-------	-12.4	-11.4	-0.04
jufo	-------------------HHHHHHHHH------------	-4.7	-16.2	-0.20
phd	--------EE--------HHH--------EEEEEE-----	+3.7	+17.4	-0.11
phdpsi	--------EE--------HHH--------EEEEEE-----	+2.2	+16.0	-0.13
prof_king	--------------------HHHHH----EEEE-------	+7.1	+5.1	+0.07
profsec	--------EEE----------EEEE---EEEEEE------	+15.1	+24.3	+0.22
prospect	-----EE----HHHH----------------HHHH-----	-11.8	-23.8	-0.26
psipred	------HHHHH-------HHHHHHHH--------------	-17.9	-12.5	-0.31
samt99_sec	----------------------HHH----EEEE-------	+7.5	+2.4	+0.06
scratch	-------------------HHHHHHH---EEEE-------	-0.5	-1.1	-0.07

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)