EVA results for 1lh8:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7...
seq	KKVLALVVAAAMGLSSAAFAAETATPAKTAAPAKTTQTTQHHKKQHKKTVEQKAQAAKKHQKKDGKKAPAKST
dssp	---HHHHHHHHH-----HHHHHH--HHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
apssp	--EHHHHHHHHH---HHHHHHHH------------------HHH----HHHHHHHHHHHHH------------	+1.8	+3.9	+0.03
apssp2	--EE-EHHHHH-----HHHHH----------------HHHHHHHHHHHHHHHHHHHHHHHH------------	-15.7	+3.5	-0.27
phd	--------HHHHHHHHHHHHHHH-HHHHHHHHHHHH----HHHHHH------HHHHHH---------------	-13.6	-25.9	-0.27
phdpsi	--------HHHHHHHHHHHHHHH-HHHHHHHHHHHH----HHHHHH------HHHHHH---------------	-16.3	-28.2	-0.31
profsec	--HHHHHHHHHH--HHHHHHHH-----------------HHHHHHHHHHHHHHHHHHHHHHHHHHHH------	-1.2	+3.4	-0.21
prospect	---HHHHHHHHH---HHHHHH-----------------HHHHHHHHHHHHHHHHHHHHHHH------------	-6.0	+7.6	-0.2
psipred	--EEEEEHHHHH----HH-------------------HHHHHHHHHHHHHHHHHHHHHHHHH-----------	-19.5	-3.7	-0.30
sspro2	-HHHHHHHHHHHHHHHHHHHHH-----------------HHHHHHHHHHHHHHHHHHHHH-------------	-14.0	-11.8	-0.33

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)