EVA results for 1ldk:E

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4.
seq	WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
dssp	-----HHHHHHH-----HHHHHHH----HHHHHHH------
apssp	-----HHHHHHHHH---HHHHHHH----HHHHHHH--HHH-	+11.1	+8.9	+0.16
apssp2	-----HHHHHHHHH---HHHHHHHH---HHHHHHH--HHH-	+1.8	+1.5	-0.02
jpred	-----HHHHHHHHHH-----HHHHHHHHHHHHHH-------	-0.7	-1.9	-0.17
phd	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHHH------	+12.2	+3.5	+0.2
phdpsi	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHHH------	+8.6	+0.2	+0.14
prof_king	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHH-------	+5.8	-0.6	0.00
profsec	----HHHHHHHHHHH----HHHHHHHHHHHHHHHHH-----	-3.3	-6.3	-0.17
psipred	-----HHHHHHHHHHH-HHHHHHHHHHHHHHH---------	-4.7	-11.9	-0.23
sspro2	-----HHHHHHHHHH---HHHHHHHHH-HHHHHH-------	+3.5	+12.7	-0.07

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)