EVA results for 1lcu:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5
seq	TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGI
dssp	---EEEEE---EEEE-E-------EEEE--EE-E----EE-HHHH--HHH
apssp	---EEEEE---EEEEEE--------EEE--EEE-----EE-HH-HH---E	+5.8	+7.9	+0.05
apssp2	---EEEEE---EEEEEE-------EEEE--EEEE----EE-HH-HH----	+2.8	-0.5	+0.09
phd	--EEEEE----EEEE---------------EE---------HHHHH---E	+1.4	-6.4	+0.04
phdpsi	--EEEEE----EEEE---------------------------HHHH----	-8.5	-22.8	-0.07
profsec	--EEEEE----EEEE--------------EE-----------HHHH---E	-10.6	-14.7	-0.16
psipred	---EEEE----EEEEEE-------EE-----------------------E	-9.7	-20.7	-0.17
sspro2	--EEEEE------E----------------------------HHHH---E	-17.2	-33.2	-0.20
jpred	--EEEEE----EEEE---------EE----E-------E---HHHH----	0	+5.3	0.00
prof_king	-EEEEEE----EEEE----------E----------------HHH----E	-6.6	-14.6	-0.08

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)