EVA results for 1l8c:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5.
seq	SDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
dssp	--------HHHH---------HHHHHHH------------HHHHHHHH---
apssp	--HHHHHE------------------E-------HHHHHHHHHHHHHHE--
apssp2	--HHHHH------------------EE--------HHH-HHHHHHHHHH--	-15.8	-24.7	-0.27
jpred	---HHHH-------------------E---------HHHHHHHHHHHH---	-10.1	-12.8	-0.27
phd	-----------------HHHHH---E--------------HHHHHHHH---	+2.6	+0.1	-0.12
phdpsi	-HHHHHHH-----------------E----------E---HHHHHHHH---	-9.8	-14.3	-0.28
prof_king	--HHHHH--------------------------------HHHHHHHHHH--	-8.5	-28.4	-0.28
profsec	--HHHHHH-------------------------------HHHHHHHHH---	-10.5	-24.6	-0.32
psipred	--HHHHH------------------EE------------HHHHHHHHHH--	-11.0	-16.5	-0.26
samt99_sec	-HHHHHHH------------------E-------HHHHHHHHHHHHHHH--	-23.7	-19.8	-0.31
sspro2	--HHHHH-----------------EEE------------HHHHHHHHHH--	-9.6	-12.4	-0.21

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)