EVA results for 1l6x:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....
seq	FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC
dssp	--HHHHHHHHHHHH-----HHHHHHHHHHHHH--
apssp	--HHHHHHHHHHH-------HHHHH-EEE-----	-2.0	+9.3	+0.01
apssp2	--HH-HHEHHHHH-------HHH-HH-HHH----	-6	-40.1	-0.14
jpred	---HHHHHHHHHH------HHHHHH-HHH-----	+8.3	+1.1	+0.10
phd	---HHHHHHHHHHH-----HHHHHHHHHHH----	+20.9	+32.1	+0.35
phdpsi	---HHHHHHHHHH-----HHHHHHHHHHHHH---	+13.7	+29.8	+0.11
prof_king	--HHHHHHHHHHH------HHHHHHHHHHHH---	+19.3	+29.7	+0.36
profsec	--HHHHHHHHHHH------HHHHHHHHHHHHH--	+20.4	+27.1	+0.44
psipred	--HHHHHHHHHHH------HHHHHHHHHHHH---	+16.5	+25.6	+0.30
samt99_sec	--HHHHHHHHHHHH-----HHHHHHHHHHHH---	+21.5	+29.0	+0.45
sspro2	--HHHHHHHHHHH------HHHHH-HHH------	+5.1	-6.7	+0.05

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)