EVA results for 1l3y:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4.
seq	ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA
dssp	----------------HHHHEEEE--EEEE-----------
apssp	------------EEE-------EEE--EEE-----------
apssp2	-------------EE------EEEE-EEEE-----------	+5.8	-4.4	+0.02
jpred	---------------------------EE------------	+2.7	+0.8	-0.05
phd	-------------EE------EEE---EEE-----------	+10.6	+1.5	+0.05
phdpsi	-------------EE------E-----EE------------	+0.6	-9.1	-0.19
prof_king	---------------------EEE--EEE------------	+12.1	+20.6	+0.24
profsec	---------------------EE----EEE-----------	+7.6	+14.5	+0.11
psipred	-------------EE------EEE--EEEE-----------	+7.1	-5.1	+0.06
samt99_sec	------------EE--------EE---EEE-----------	+3.3	-0.9	-0.08
sspro2	-------------E-------EEE--EEEE-----------	+11.0	+0.9	+0.16

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)