EVA results for 1l3e:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	GSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
dssp	------------HHHHHHH------------HHHHHHH----
apssp	----------------E---------HHHHHHHHHHHHH---	-6.5	+2.7	-0.26
apssp2	----------------EE--------HH--HHHHHHHHH---	-8.7	-11.8	-0.30
phd	-------------------------------HHHHHHHH---	+10.7	-6.9	0.00
phdpsi	----------------E--------------HHHHHHHH---	+6.5	+13.1	-0.01
prof_king	------------------------------HHHHHHHHHH--	+1.4	-13.6	-0.18
profsec	------------------------------HHHHHHHHHH--	-0.4	-16.2	-0.21
psipred	----------------EE------------HHHHHHHHHH--	-1.3	+6.6	-0.15
samt99_sec	-----------------E-------HHHHHHHHHHHHHHH--	-11.2	-4.3	-0.28
sspro2	----------------EE--------H---HHHHHHHHHH--	-3.4	-5.7	-0.17

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)