EVA results for 1l1c:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDV
dssp	--EEEEEE--EEEEE-----EEEEE---------------HHH--EEEEEE----
apssp	-HHHHHH---EEEEEE----EEEEE---------------HH--EEEEEE-----
apssp2	-EEEEEE---EEEE------EEEEEE--------------HHH--EEEEE-----	+16.2	+27.9	+0.30
jpred	---HHHH---EEEEE-----EEEEE-------------------EEEEEE-----	+7.1	+11.8	+0.16
phd	--EEEEE---EEEEE-----EEEEE---EEEE-----------EEEEEEEE----	+11.9	+5.1	+0.17
phdpsi	-EEEEE----EEEEE----EEEEEEE---EEEE----------EEEEEEEEE---	+0.1	-1.7	-0.03
profsec	-EEEEE----EEEEE-----EEEEEE-EEEEE-----------EEEEEEEEE---	-2.5	-8.5	-0.07
psipred	-EEEEEE---EEEEE-----EEEEEE--------------HHH--EEEEE-----	+16.9	+25.4	+0.33
samt99_sec	-EEEEEE---EEEEE-----EEEEE---------------HHHHHEEEEE-----	+16.2	+24.2	+0.32
sspro2	--EEEEE---EEEEE-----EEEEEE-EEEEE--------HHHHEEEEEE-----	+7.4	+3.5	+0.11

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)