EVA results for 1kys:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....
seq	GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQC
dssp	-HHHH---EEEEEEEEEEE--EEEEEEEEEEEEHHH-EEEEEEEE--------HHHH-----HH
apssp	-------EEEEEEEEEEEE--EEEEEEEEEEEE----EEEEEEE----------HH------HH	+7.2	+11.4	+0.27
apssp2	---EE--EEEEEEEEEEEE--EEEEEEEEEEEE----EEEEEEEE--------HHHH-----HH	+5	+8	+0.15
jpred	----E--EEEEEEEE-------EEEEE------------EEEEEEE------------HHH-HH	-19.3	-11.9	-0.15
phd	--EEE---EEEEEEE--------EEE------------EEEEEEE-----------EEEEHHHH	-17.1	-10.3	-0.16
phdpsi	--HHHH--EEEEEEEEE-----EEEEEE--------EEEEEEEEE-------HHHHHHHHHHHH	-5.6	+3.6	+0.06
prof_king	--EEEE-EEEEEEEEE-----EEEEEEEE---------EEEEEEEE-----------HHHHHHE	-18.5	-5.0	-0.14
profsec	--HHHHHEEEEEEEEEEEE--EEEEEEEEE-------EEEEEEEEE------HHHHHHHHHHHH	-3.2	+1.3	+0.09
psipred	---EEEEEEEEEEEEEEEE---EEEEEEEE-------EEEEEEEEEE-------HHHHHHHHHH	-11.9	-5.7	-0.13
sspro2	--HH----EEEEEEEE-----EEEEEEE----------EEEEEEEE-------HHHHHHHHHHH	-8.4	+1.5	-0.01

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)