EVA results for 1ktz:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....
seq	ENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSASASPCCVPQDLE
dssp	---EEE--EEEHHHHH----EEE--EEE--EEE--------------EEE--EE
apssp	--------EEEHHHHH----EEE--EEE--EEE--------------EEE--EE	+19.5	+19.6	+0.45
jpred	-------EEEE-------EEEEE------EEE---------------E------	-11.4	-15.6	-0.23
phd	---EEEEEEEEE------EEEEE----EEEEE---------------E------	-2.8	-10.1	-0.12
phdpsi	---EEEEEEEEE------EEEEE----EEEEE---------------E------	-7.8	-14.7	-0.20
profsec	---EEEEEEEEE------EEEEE----EEEEE----------------------	-11.9	-21.8	-0.26
psipred	---EE---EEEHHHH----EEE----EE--EE----------------EEEEEE	+5.9	+15.1	+0.08
sspro2	-----EEEEEE-HHH----EEE------EEE-----------------------	-14.5	-16.5	-0.17

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)