EVA results for 1ks0:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....
seq	RIPVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEA
dssp	------E----------EEE--EEE---E---------EEE---EHHHH--EEE-----
apssp	-EEEE-------E----EEE---EE---E---------EEE------------------	+0.2	-13.0	-0.17
jpred	--------------EEEEE--------E-------------------------------	-9.9	-36.0	-0.32
phd	--EEEE------EEEEEEEE----------------EEEEE------------E-----	-8.2	-16.9	-0.18
phdpsi	-EEEEEE------EE---EE-----HHH----------EEE------------E-----	-11.8	-16.7	-0.22
prof_king	-EEEEE-------EEEEEEE----EEEEEEE-----EEEEE----------EEE-----	-15.7	-15.4	-0.22
profsec	-EEEEEE------EEE-EEE---EEEEE---------EEEE-----------EE-----	-10.7	-15.6	-0.22
psipred	-EEEEE-----------EEE--EEHHHH-----------------HHH-----------	-9.0	-14.6	-0.25
sspro2	--EEE---------EEEEEE---EE-------------EEEE-----------------	-8.0	-17.8	-0.28

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)