EVA results for 1krl:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....
seq	REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
dssp	----EEEEEEEEEE--EEEEEEEEEE-----EEEEEEE------
apssp	-----HH-EEEEEE--EEEEEEEEEE-----EEEEEE-------	+13.7	+27.9	+0.27
jpred	------EEEEEEE-------------------EEEE--------	-10.8	-5.7	-0.10
phd	--EEEEEEEEEEEE--EEEE---HHHH-----EEEEE-------	+5.4	+23.0	+0.02
phdpsi	--EEEEEEEEEEEE--EEEE---HHHH-----EEEEE-------	+0.4	+18.4	-0.05
profsec	-----EEEEEEEEE--EEEEE--HHHH------HHH--------	-8.5	+2.7	-0.01
psipred	------EEEEEEEE---EEE----HHHHHH--EEEE--------	-13.7	+2.5	-0.12
samt99_sec	-----EEEEEEEEE--HH------HHHHH---EEEE--------	-14.3	-1.5	-0.12
sspro2	--E--EEEEEEEEE---EEEEE----------EEEE--------	-0.2	+8.2	-0.09

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)