EVA results for 1kqs:1

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3.
seq	GKKSKATKKRLAKLDNQNSRVPAWVMLKTDE
dssp	----HHHHHHHHHHHHH-----HHHHHH---
apssp	---HHHHHHHHHHHH--------EEEEE---	-3.8	+8.8	+0.03
jpred	----HHHHHHHHHHH-------EEEEEE---	-0.2	+10.8	+0.24
phd	----HHHHHHHHHHHH-------EEEEE---	+7.8	+15.0	+0.34
phdpsi	----HHHHHHHHHHHH-------EEEEE---	+2.8	+10.4	+0.26
profsec	----HHHHHHHHHHHH-------EEEEE---	+0.6	+7.7	+0.22
psipred	----HHHHHHHHHH--------EEEEEE---	-6.3	+4.6	+0.12
sspro2	----HHHHHHHHH---------EEEEE----	-9.8	+3.8	+0.02

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)