EVA results for 1koz:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV
dssp	-------E----------EE--------E-EE----
apssp	---EEE----------------------EEEE----	+3.9	-22.1	-0.29
apssp2	---E-------------HHHH-------EEE-----	-5.3	-9.6	-0.35
prof_king	--EEEE-------------E-------EEEEE----	+3.2	-5.0	-0.20
prospect_secstruc	--------------HHHHHHHHH-------------	-7.8	-19.2	-0.31
psipred	---HHH------------HHH------EEEE-----	-5.6	-9.8	-0.28
samt99_sec	--EEE-----------------------EEEE----	+5.0	-23.3	-0.25
sspro2	-EEEEE----------------------EEEE----	-1.8	-29.0	-0.32
prospect	--------------HHHHHHHHH-------------	-7.8	-18.9	-0.31

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)