EVA results for 1kma:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	FQGNPCECPRALHRVCGSDGNTYSNPCMLTCAKHEGNPDLVQVHEGPCDEHDHDF
dssp	--------------EE-----EE--HHHHHHHHHHH-------E-----------
apssp	--------------------------HHHHHH-------EE-EE-----------	+1.5	-10.3	-0.07
apssp2	---------HHHHHHH----------EEEEE--------EE-E------------	-27.1	-26.7	-0.38
phd	--------------EE------E---EEEEEEE-----EEEEEE-----------	-1.5	+2.3	-0.04
phdpsi	--------------EE------E---EEE---------EEEEE------------	-6.9	-2.6	-0.24
prof_king	-------------------------HHHHHHHHHH----EEEEE-----------	+8.9	+2.2	+0.20
profsec	---------------------EE----EEEEEEE----EEEEEE-----------	-9.3	-12.1	-0.18
psipred	--------HHHHHHHH----------EEEEE--------EEEEE-----------	-23.4	-18.7	-0.29
sspro2	--------H-------------------HHHHHH------EEE------------	-2.4	-7.5	-0.12

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)