EVA results for 1kk3:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELR
dssp	---EEEEEEEE------HHHHHHHHH----------
apssp	-----EEEEEE------HHHHHHHHHHHHHHHHHHH	-8.8	-7.9	+0.12
apssp2	----EEEEEEEEEE---HHHHHHHHHHHHHHHHHHH	-21.4	-20	-0.12
jpred	-----EEEEEEEEE------EEEEEEHHH-HHHHHH	-37.9	-28.6	-0.09
phd	------EEEEEEE----HHHHHHHHHHH--------	+10.3	+26.4	+0.25
phdpsi	------EEEEEEE----HHHHHHHHHHH--------	+6.1	+22.6	+0.19
prof_king	----EEEEEEEEEE-----HEHHHHHHHHHHHHHH-	-19.1	-23.0	-0.10
profsec	-----EEEEEEEE----HHHHHHHHHHH--------	+6.6	+25.4	+0.18
psipred	----EEEEEEEE-----HHHHHHHHHHHHHHHHHHH	-10.8	-10.0	+0.07
sspro2	-----EEEEEEEE---------HHEE---HHHHHHH	-27.2	-13.8	-0.21

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)