EVA results for 1kk2:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELR
dssp	------EEEEE------HHHHHHHHH------HHH-
apssp	-----EEEEEE------HHHHHHHHHHHHHHHHHHH	+2.2	-4.5	+0.18
apssp2	----EEEEEEEEEE---HHHHHHHHHHHHH-HHHHH	-13.1	-6.8	-0.05
jpred	-----EEEEEEEEE------EEEEEEHHHHHHHHHH	-29.6	-27.5	-0.16
phd	------EEEEEEE----HHHHHHHHHHH--------	+10.3	+17.8	+0.22
phdpsi	------EEEEEEE----HHHHHHHHHHH--------	+6.1	+14.0	+0.16
prof_king	---EEEEEEEEEEE-----EEEEEEEEE---HHHH-	-24.7	-17.6	-0.16
profsec	-----EEEEEEEE----HHHHHHHHHHH--------	+1.1	+9.6	+0.09
psipred	----EEEEEEEE-----HHHHHHHHHHHHHHHHHHH	-5.3	-10.0	+0.08
sspro2	----EEEEEEEEE----------HHHHHHHHHHHH-	-21.6	-21.6	-0.10

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)