EVA results for 1kjy:D

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....
seq	DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEF
dssp	-HHHHHHHHHHH-------------HHHH-----
apssp	-HHHHHHHHHHH------HHHHHHHHH-------	-3.1	+8.7	-0.2
apssp2	--HHHHHHHHHHH-----HHH--HHHH-------	-10.0	-17.2	-0.36
jpred	-HHHHHHHHHHHH-----HHHHHHHH--------	-6.4	+1.6	-0.22
phd	-HHHHHHHHHHHHH---HHHH--------EE---	-5.9	-11.0	-0.13
phdpsi	-HHHHHHHHHHHHH---HHHH--------EE---	-9.5	-14.3	-0.19
prof_king	-HHHHHHHHHHHH---------------------	+10.6	+1.0	+0.07
profsec	-HHHHHHHHHHHH----HHHH-HHHHH-------	-6	-17.0	-0.20
psipred	-HHHHHHHHHHHHH----HHH----HH-------	+1.4	-6.6	-0.12
sspro2	-HHHHHHHHHHHH---------H--H--------	+8.3	-1.1	+0.01

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)