EVA results for 1kjy:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,
seq	DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFL
dssp	-HHHHHHHHH----HHHH-------HHHH------
apssp	-HHHHHHHHHHH------HHHHHHHHH--------	+1.8	+3.9	+0.03
apssp2	--HHHHHHHHHHH-----HHH--HHHH--------	-17.5	-6.9	-0.33
jpred	-HHHHHHHHHHHH-----HHHHHHHH---------	-21.4	-17.9	-0.33
phd	-HHHHHHHHHHHHH---HHHHH-------------	-12.7	-15.6	-0.26
phdpsi	-HHHHHHHHHHHHH---HHHHH-------------	-15.4	-17.9	-0.30
prof_king	-HHHHHHHHHHHH------------------H---	-7.5	-22.3	-0.24
profsec	-HHHHHHHHHHHH----HHHH-HHHH---------	-18.1	-13.6	-0.34
prospect	HHHHHHHHHHHHHH---HHHH--EE----------	-20.4	-16.8	-0.25
psipred	-HHHHHHHHHHHHH----HHH---HHH--------	-15.7	-8.7	-0.34
sspro2	-HHHHHHHHHHHH------HHHHHHHH-----H--	-20.0	-19.5	-0.34

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)