EVA results for 1kj6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,
seq	GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
dssp	---------HHHHH--EEE-------EEEEE-------EEEEE--
apssp	-----EHHHH-E-----EEEEE-----------------------
apssp2	-HHHHHH-HEHHH----EEEEE----HHH-----HHHHHHHH---	-34.6	-31.5	-0.32
jpred	---------EE-----EEEEE-------E----------------	-8.4	-13.9	-0.23
phd	----------------EEEE--------EEEEE-------EEE--	+3.4	+8.3	-0.00
phdpsi	----------------EEEE--------EEEEE-------EEE--	+0.7	+6.0	-0.04
profsec	----------------EEEE--------EEEE------EEEEE--	+4.7	+7.6	+0.08
psipred	-HHHHHHHHHHEE---EEEEEEE----HH----HHHHHHHH----	-42.4	-38.8	-0.34
samt99_sec	--HHHH-----E----EEEEE------EEEEE-------E-----	-12.5	-9.6	-0.16
sspro2	-HHHHHHHHEHE-----EEEEE-----HH----------------	-32.1	-36.6	-0.31

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)