EVA results for 1ke9:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR
dssp	---EEEEEEEEE---EEEEEEEE-----EEEEEEE-
apssp	---EHHHEEE-----EEEEEEE------EEEEEEE-	+6.6	-2.1	+0.16
apssp2	---EEEEEEEE----EEEEEEEE-----EEEEEEE-	+13.6	+20.6	+0.29
phd	----EEEE--------EEEEEEE----EEEEEEE--	+7.1	+19.4	+0.02
phdpsi	----E-HHHH------EEEEEEE-----EEEEEE--	-2.0	+3.6	+0.08
prof_king	--H-----------EEEEEEE------EEEEEEE--	-16.3	-5.0	-0.22
profsec	----EEEEEE-----EEEEEEEE-----EEEEEEE-	+15.1	+25.3	+0.28
psipred	----EEEEEEEE---EEEEEEEE-----EEEEEEE-	+19.2	+25.3	+0.42
sspro2	----EEE-E-----EEEEEEE-------EEEEEEE-	+0.8	-4.3	-0.08

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)