EVA results for 1kbe:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....
seq	GSVTHRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPACR
dssp	------EEEE----------------EEEE----EEE------------
apssp	----EE-------EEHHE-HH-HHEEE--------E-------------	-18.8	-30.7	-0.29
jpred	------EEEE-----------------EEE-----EE------------	+21.6	+30.9	+0.39
phd	--EEEE---HHHHHHHHHHH---EEEEEE---EEE--------------	-22.8	-13.3	-0.22
phdpsi	--EEE-EE-------HHHHHHHHHH-----------HHHH---------	-25.4	-28.0	-0.26
prof_king	---EE------HHHHHHHHHHHHHH----E-------------------	-28.2	-39.5	-0.20
profsec	--EE-----------HHHHHHHHHH----------EEHHHH--------	-27.9	-29.7	-0.22
psipred	----EEE--HHHHHHHHHHHHHH-EE-----EEEEEE------------	-31.7	-24.9	-0.33
samt99_sec	------EEEEE--------H-HHH----EEEE--EEE--H-H-------	+1.4	-24.3	0.00
sspro2	--EEEEE--HHHHHHHHHHHH--EEEEEE----EE--------------	-28.6	-17.3	-0.35

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)