EVA results for 1kam:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	SKKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIP
dssp	--EEEEEEE------HHHHHHHHHHHHH----EEEEEE----
apssp	--EEEEE---------HHHHHHHHHHHH----EEEEE-----	+6.5	+19.8	+0.20
apssp2	--EEEEE------HHHHHHHHHHHHHHHH---EEEEE-----	+11.0	+27.9	+0.31
jpred	---EEEE---------HHHHHHHHHHHHH---EEEEE-----	+12.8	+29.0	+0.30
phd	--EEEEEE------HHHHHHHHHHHHHHH--EEEEEEE----	+20.6	+31.5	+0.43
phdpsi	--EEEEEE------HHHHHHHHHHHHHHH--EEEEEEE----	+17.9	+29.2	+0.39
prof_king	--EEEEE---------HHHHHHHHHHHH---EEEEEE-----	+14.8	+30.4	+0.35
profsec	--EEEEEE--------HHHHHHHHHHHH----EEEEE-----	+17.6	+27.9	+0.42
prospect	--EEEEE----------HHHHHHHHHHHH---EEEEE-----	+13.8	+30.6	+0.30
psipred	--EEEE---------HHHHHHHHHHHHHH--EEEEEEE----	+12.3	+22.4	+0.30
samt99_sec	--EEEEEE-------HHHHHHHHHHHHH----EEEEE	+22.6	+30.7	+0.57
sspro2	--EEEEE--------HHHHHHHHHHHHH----EEEEE-----	+18.5	+30.6	+0.48

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)