EVA results for 1k8v:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....
seq	PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF
dssp	------------------HHHHHHHHHHHHHHHHH----
apssp	-----E------EHH-HHHHHHHHHHHHHHHHHH-----	+3.1	+6.8	+0.06
apssp2	-----E--HHHHEE--HHHHHHHHHHHHHHHHHH-----	-0.2	-24.9	-0.01
jpred	-----E----------HHHHHHHHHHHHHHHHH------	+14.3	+6.8	+0.15
phd	----EEE--------HHHHHHHHHHHHHHHHHHH-----	+12.2	+2.3	+0.2
phdpsi	----EEE---------HHHHHHHHHHHHHHHHHH-----	+12.0	+1.8	+0.22
profsec	----EEE---------HHHHHHHHHHHHHHHHHH-----	+9.3	-1.8	+0.18
prospect	-----EE--HHHHH--HHHHHHHHHHHHHHHH-------	-2.6	-23.3	-0.12
psipred	--------HHHHEE--HHHHHHHHHHHHHHHHHH-----	+1.1	-9.5	-0.02
samt99_sec	-----EE---------HHHHHHHHHHHHHHHHHH-----	+12.5	+2.6	+0.21
sspro2	----EEE------E--HHHHHHHHHHHHHHHHHH-----	+7.7	-17.3	+0.18

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)